Concatenated MHC class I peptide sequences from Rammensee et al, Immunogenetics 41:178



Return to HLA peptide motif search page
Return to HLA peptide motif info and background page


The listing below is a concatenation of peptide sequences that are known to bind to MHC class I molecules. This is the best test sequence for the HLA coefficient tables used on this Web site.

GGTYQRTRALVGGSYFPEITHIGGGYKDGNEYIGGKYGVSVQDIGGGYLGQVTAIGGSFV
DTRTLLGGLYQNVGTYVGGTYVSVGTSTLGGVYQILAIYAGGIYATVAGSLGGTYVSVST
STLGGIYSTVASSLGGRYLENGKETLGGRYLKNGKETLGGSYIPSAEKIGGSYVPSAEQI
GGSYIGSINNIGGDYATLGVGVGGLYRTFAGNPRAGGTYKDTVQLGGFYDGFSKVPLGGA
YISSGSSTLGGNYDNAGTNLGGKYLKKIKNSLGGKYLKIKHLLGGKGPITVQIGGVGPQK
NENLGGSGPRKAIALGGAGPDRTEKALGGKGPDKGNEFGGIGPERGHNLGGDGPVREHNL
GGKGPERANGLGGSGPERGEKLGGDGPVRGISLGGNGPQRIYNLGGSGPVALVNFGGIGP
NRAFNFGGSGPERLLSAYGGVGPSGKYFILGGFGPYKLNRLGGFGPLKFNVLTGGAGPDR
FIAAMGGFGPYRFYVLTGGSAHKEQPATGGSAPKTDAQTLGGGPPHSNNFGYGGRGPGRA
FVTIGGLMGYIPLVGAGGYPHFMPTNLGGLSPFPFDLGGAPLEANYQAFGGAPQPGMENF GGQPQRGRENFGGAPQPGREQGGAPQPNLYQLGGYPNVNIHNFGGAPQKAGGFLMGGRPQ ASGVYMGGISTQNHRALGGLPYLGWLVFGGAPTAGAFFFGGYPALGLHEFGGTPHPARIG LGGDVPIDRLYLGGSPGRSFSYFGGRGYVYQGLGGSIINFEKLGGHIYEFPQLGGIIYRF LLIGGSSIEFARLGGFAPGNYPALGGKSPWFTTLGGVGPVFPPGMGGYSGYIFRDLGGFE QNTAQAGGASNENMETMGGIQVGNTRTIGGASNENMDAMGGSAINNYAQKLGGCKGVNKE YLGGQGINNLDNLGGSGPSNTPPEIGGFQPQNGQFIGGSGVENPGGYCLGGKAVYNFATC GGGKAVYNFATCGAGGRAHYNIVTFGGNNLDNLRDYGGNNLDNLRDYLGGHETTFNSIGG DDHRAGKIGGYEDTGKTIGGKEMKAKVIGGEEEPVKKIGGSEIVGKRIGGSEGGSHTIGG DERTVRKIGGEEDPVKKVGGEAYLGKKVGGFEANGNLIGGIEGGWTGMIGGSDYEGRLIG GFESTGNLIGGSEFLLEKRIGGYENDIEKKIGGDELDYENDIGGTEMEKEGKIGGVEAEI AHQIGGEEGAIVGEIGGKQNPIAHQLGGALAELPHELGGKQNPTVHHLGGAGLLGMRSGL GGKLIKVYHHSLGGVQNATMHPIGGRSNGQVHMLGGKLTGIKHELGGAMLATYHKLGGGQ LAVAHKLGGILMEHIHKLGGAQNPVLYQIGGSLIKTVREMGGKMLPVEHNLGGKQLIVTY HLGGSVLDDLALLGGYESPLMAFLGGDLLGTLHNLGGATDFKFAMYGGIADMGHLKYGGM IEPRTLQYGGYTSDYFISYGGLTDPGVLDYGGVSDIVGPDGLVYGGYTDYGGLIFNSYGG QSEDGSHTIQIMYGGYLDDPDLKYGGSTDHIPILYGGDSDGSFFLYGGGTDEARNAYGGV SDPYNAKYGGVADKVHAMYGGYTAVVPLVYGGYTNPQFNVYGGETAAPDWSYGGFTDVNS AARYGGSSEQTFMYYGGSTEPVNILYGGGTDPGVLIYGGSTEPPMLNYGGSLEPQRTQYG GFTEVSIRKYGGKFDPVNLVYGGAVDPGGMYSGGFGSGARDAYGGYAEPQFLTYGGAEIP AFINYGGITEDMGHLKYGGETDAAADRSEYGGEADPTGHSYGGVSDGGPNLYGGCTELKL SDYGGEVDPIGHLYGGSLLPAIVELGGYLLPAIVHIGGTLWVDPYEVGGSLPSGGLGVGG GLVPFLVSVGGSLLVRALEVGGKLNEPVLLLGGALWGFFPVLGGLLDVPTAAVGGVLFRG GPRGLLAVAGGMVDGTLLLLGGYMNGTMSQVGGMLLSVPLLLGGSLLGLLVEVGGALLPP INILGGTLIKIQHTLGGILAPPVVKLLVGGALFPQLVILGGGILGFVFTLGGILKEPVHG VGGLLFGYPVYVGGGLSPTVWLSVGGWLSLLVPFVGGFLPSDFFPSVGGCLGGLLTMVGG FIAGNSAYEYVGGKLGEFYNQMMGGKLVALGINAVGGDLMGYIPLVGGRLVTLKDIVGGM LLALLYCLGGAAGIGILTVGGYLEPGPVTAGGILDGTATLRLGGKLFKMILRKGGKLFKN ILYKGGYLAVRAALIVGGKLHKQRAKSGGSLFKQVVTKGGKAFVKLLAYGGSLFNTHLAK GGTLANDAVVPGGGIFAAAAAVKAGGTAFVKALAYGGSLFDHILAKHGGKLFKVVANYGG KLYEKVYTYKGGKLFNIMVTYGGKLFEKVYNYGGKLFKVTFSYGGGLFPAQFAYGGSLFE LVFAYGGSLAEKTFDYGGSLHKYAFEYGGKMFNITVTYGGKLFVKVYNYGGKIVRKPGMA GGRLRDLLLIVTRGGQVPLRPMTYKGGTVYYGVPVWKGGRLRPGGKKKGGILRGSVAHKG GRIRLRPGGKGGLQFPVGRVHRGGQQLYWSHPRGGRGYRPRFRRGGKVFGPIHERGGKIM KWNYERGGRYMDAWNTYSRGGSTLPETTVVRRGGDMAAQITQRGGESGPSIVHRGGTYYG SFVTRGGDYIHIRIQQRGGEIMKWNRERGGTIMPKDIQLARRGGIVGLNKIVRGGAVAAV AARRGGEVAPPEYHRGGEVAPPEYHRKGGDVFRDPALKGGKTGGPIYKRGGEVILIDPFH KGGTVFDAKRLIGRGGAVLKAIAKRGGPVKQVVYHRGGESGPSIVHRKGGTTATTTNARG GDTTPTAARGGSTLPETTVVRRGGAPRTVALTAGGAPRTVALTALGGAPRALLLLLGGAP RLPLTGLGGAPRASRPSLGGAPRTLVLLLGGMPRGVVVTLGGSPRYIFTMLGGAPAPTVA VLGGRPSGPGPELGGLVMAPRTVLGGRVMAPRALLGGAPRAFLPLPVGGAASKERSGVSL GGAPRSNGMVLGGAPRQPGLMAGGAPAPPPKPMGGAPYGGPLALGGTPGPGVRYPLGGHP KYKTELGGILKQKIADLGGELKVKNLELGGVPKLKVLALGGFAKPRVGGGGSPKLKYMQG GELKKKTNIGGSPKEKIAYGGAAKAKLADGGSPKEKYEAGGELKEKTQLGGLPKVKLALG GHPKYKTELGGVLDLKIVAFGGGPKEKAAMGGGLKVKGNEFGGFLKPKFVALGGELKIKV YAIGGSLKEKVALGGELKEKAYELGGIPKLKNVKRGGSLKIKALGGDLKQKNELGGELRS RYWAIGGFLRGRAYGIGGEIYKRWIILGGGEIYKRWIIGGEIKDTKEALGGSRDKTIIMW GGGRLTKHTKFGGRRFVNVVPTFGGKRYKSIVKYGGKRKKAYADFGGKRGILTLKYGGGR FGVGNRYGGGRFKLIVLYGGGRLTKHTKFGGARLFGIRAKGGRRLGAQYRRGGRRFGDKL NFGGGRVFIIKEGGGRAAIFARFGYHGGTRYPILAGHGGRRISGVDRYGGKRFSFKKSFG GARLQTALLGGRRAPIFSRLGGRRFMQYYVYGGRRIKEIVKKHGGRRMGPPVGGHRGGRR IKEIVKKGGGRIDKPILKGGRRSKEITVRGGKRFEGLTQRGGRRVKEVVKKGGFRYNGLI HRGGRRYQKSTELGGRRWLPAGDAGGRRISGVDRYGGRRFTRPEHGGKKYQKSTELGGSR YWAIRTRGGRRRWRRLTVGGRRYPDAVYLGGRRIYDLIELGGKRWIILGLNKGGGRAFVT IGKGGRRKAMFEDIGGKPKDELDYGGKSKDELDYGGKPNDKSLYGGASRCWVAMGGEDLR VLSFIGGEHAGVISVLGGTHDELEDKLGGQYDEAVAQFGGYPDPANGKFGGSHIGDAVVG GYHEDIHTYLGGTFDVAPSRLGGSHIGDAVVGGIHEPEPHIGGSRDKTIIMGGTEFPKER HLRLGGGEFPNKNALGGGEFPNKNALYAGGGEFPGKIFLYAGGWEFLQPILLGGGEFIPG NDLHRGGGEFPPADNWGGEEFYVDLERGGNEFPDIDIRGGAEFPKAEARGGAEIGEVIVL WAWGGAEIPGEIALGGGEILDVFDAGGFEIPALDVAGGDEVTPQPQLVGGKEVGVDVALY AGGKESTLHLVLGGHEETPPTTSGGGEVDVEQHTGGAEDKENYKKFGGAEMGKGSFKYGG EENLLDFVRFGGYPFKPPKVGGDAHIYLNHIGGTGYLNTVTVGGDAYALNHTLGGLPPEV NRQLGGYAYDGKDYIGGYPFKPPKVGGLPPGRIIKAGGLPFTVILVGGTGYLNTVTVGGF AYDGKDYIGGFPSEIVGKRIGGMPWFKGWKVGGTGYLNTVTVGGDAHIYLNNIGGYFDDT LEDFGGTGYLNTVTVGGGQFKTYAIGGHSTIMPRLGGGFYPGSIEVGGVQIFGNKMGGYP DPANGKFGGLQFPVGRIGGHMYIFLHTVGGKAGQVVTIWGGAGDRTFQKWGGITTKAISR FGGRTDGKVFQFGGITSQDVLHSWGGISDSNPFLTQGGKTDEVVTLFGGVTSPLTVEWGG GAVNVVMTFGGKESTLHLVLGGHEATLRCWALGGYEIHDGGMNLGGSESPIVVVLGGIEV DPDTKEMLGGGEFGGFGSVGGEEFQFIKKAGGGEFVDLYVGGRERRDNYVGGREIIINAV GGGEFSITYKGGGEHGLIIRVGGREMIPFADIGGVLKPGMVVTFGGYLGEFSITVGGGQR KGAGSVGGKIKSFVKVYGGIQPGRGFVLYGGSQFGGGSQYGGGQRKPATSYGGVQGPVGL GGILGNKIVRMYGGHQAISPRTLGGSFNCGGEFFGGYQFTGIKKYGGVRHDGGNVLGGFA FPLIQRVGGAQRTPKAGLYYGGKYFDEHYEYGGRYRPGTVALGGNKADVILKYGGIYPQN VILYGGIRKPYIWEYGGNYGGGNYGSGSYGGFYPPYLYGGAMPPFLDG